Margatoxin

La margatoxina (MgTX) es un péptido que inhibe selectivamente los canales de potasio dependientes de voltaje Kv1.3 . Se encuentra en el veneno de Centruroides margaritatus , también conocido como escorpión de corteza centroamericano. La margatoxina fue descubierta en 1993. Se purificó a partir del veneno del escorpión y se determinó su secuencia de aminoácidos .

La margatoxina es un péptido de 39 aminoácidos con un peso molecular de 4185 Dalton. La secuencia primaria de aminoácidos de la margatoxina es la siguiente:

Thr-Ile-Ile-Asn-Val-Lys-Cys-Thr-Ser-Pro-Lys-Gln-Cys-Leu-Pro-Pro-Cys-Lys-Ala-Gln-Phe-Gly-Gln-Ser-Ala-Gly-Ala-Lys-Cys-Met-Asn-Gly-Lys-Cys-Lys-Cys-Tyr-Pro-His

O, cuando se traduce a una secuencia de una letra,

TIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH.

Existen puentes disulfuro entre Cys7-Cys29, Cys13-Cys34 y Cys17-Cys36. La margatoxina está clasificada como una "toxina corta de escorpión" por Pfam , mostrando homología de secuencia con otros bloqueadores de canales de potasio, como la charybdotoxina (44%), la kaliotoxina (54%), la iberiotoxina (41%) y la noxiustoxina (79%), que también se derivan del veneno de escorpión. ^{[ 2 ]}

La margatoxina es un péptido purificado originalmente del veneno del escorpión Centrutoides margaritatus (escorpión de corteza centroamericano). Las toxinas de escorpión son específicas y tienen una alta afinidad por sus dianas, lo que las convierte en herramientas útiles para caracterizar diversas proteínas receptoras implicadas en el funcionamiento de los canales iónicos . Dado que solo se pueden aislar pequeñas cantidades de toxinas naturales del veneno de escorpión , se ha utilizado un método de síntesis química para producir suficiente proteína para la investigación. Este método no solo produce suficiente material para estudiar los efectos sobre los canales de potasio , sino que también garantiza la pureza, ya que la toxina aislada del veneno de escorpión corre el riesgo de contaminarse con otros compuestos activos. ^{[ 3 ]}

Margatoxin can be chemically synthesized using the solid phase synthesis technique. The compound gained by this technique was compared with the natural, purified margatoxin. Both compounds had the same physical and biological properties. The chemically synthesized margatoxin is now used to study the role of Kv1.3 channels.^[2]

Margatoxin blocks potassium channels Kv1.1 Kv1.2 en Kv1.3. Kv1.2 channel regulates neurotransmitter release associated with heart rate, insulin secretion, neuronal excitability, epithelialelectrolyte transport, smooth muscle contraction, immunological response and cell volume. Kv1.3 channels are expressed in T and B lymphocytes.^[4] Margatoxin irreversibly inhibits the proliferation of human T-cells in a concentration of 20 μM. At lower concentrations, this inhibition is reversible.

Margatoxin significantly reduces outward currents of Kv1.3 channels and depolarized resting membrane potential. It increases the time necessary to conduct action potentials in the cell in response to a stimulus. Acetylcholine (ACh) plays a key role in activation of nicotinic and muscarinic ACh-receptors. Margatoxin influences nicotinic ACh-receptor agonist-induced norepinephrine release. Upon activation of muscarinic ACh receptors with bethanechol, margatoxin-sensitive current was suppressed. Therefore, it was concluded that Kv1.3 affects the function of postganglionic sympathetic neurons, so one could suggest that Kv1.3 influences sympathetic control of cardiovascular function.^[5]

Kv1.3-channels can be found in various cells, including T-lymphocytes and macrophages. To activate an immune response a T-lymphocyte has to come into contact with a macrophage. The macrophage can then produce cytokines, such as IL-1, IL-6, and TNF-α. Cytokines are cell signaling molecules that can enhance the immune response. Kv1.3-channels are important for the activation of T-lymphocytes, and thus for the activation of macrophages. The disturbance of the function of Kv1.3-channels, for example due to inhibition of these channels, will lower the cytokines production and lymphocyte proliferation in vitro. This would lead to immune response suppression in vivo.

Kv channels are regulated during proliferation and regulation of macrophages and their activity is important during cell responses. In contrast to leukocytes which have monomeric Kv1.3 channels, macrophages have heterotetrameric Kv1.3/Kv1.5 channels. These heterotetramers plays a role in regulating the membrane potential of macrophages on different stages of macrophage activation by lymphocytes. Potassium channels are involved in leukocyte activation by calcium. The possible different conformations of these Kv1.3 and 1.5 complexes can affect the immune response. Margatoxin inhibits Kv1.3 channels, so no heterodimers can be formed. The effect of margatoxin is similar to the effect of DEX. DEX diminishes amount of K1.3 channels by binding to GC receptor, which leads to downregulating of expression of K1.3 channels. Both margatoxin and DEX lead to immune suppression.^[6]

Los canales iónicos desempeñan un papel fundamental en la transducción de señales de los linfocitos . Los canales de potasio son necesarios para la activación de las células T. La inhibición farmacológica de los canales de potasio puede ser útil en el tratamiento de enfermedades inmunitarias. El potencial de membrana ejerce efectos importantes sobre la activación de los linfocitos . El potencial de reposo resulta principalmente de un potencial de difusión de potasio generado por los canales de potasio . La margatoxina despolariza las células T humanas en reposo. Estudios farmacológicos sugieren que los canales de potasio funcionales son necesarios para la activación de las células T y B. Los bloqueadores de los canales KV inhiben la activación, la expresión génica, la citotoxicidad por células T citotóxicas y células NK, la secreción de linfocinas y la proliferación. La margatoxina bloquea la proliferación inducida por mitógenos , la respuesta linfocitaria mixta y la secreción de interleucina-2 e interferón gamma (IFN-γ). Esto proporciona la evidencia más sólida disponible sobre el papel de los canales KV en la mitogénesis. ^{[ 7 ]}

La margatoxina puede tener varios efectos diferentes en el cuerpo: ^{[ 8 ]}

• Puede provocar irritación cutánea.
• Puede ser perjudicial si se absorbe a través de la piel.
• Puede provocar irritación ocular.
• Puede ser perjudicial si se inhala.
• El material puede irritar las membranas mucosas y las vías respiratorias superiores.
• Puede ser perjudicial si se ingiere.
• La exposición prolongada o repetida puede provocar reacciones alérgicas en ciertas personas sensibles.
• Puede ser mortal si entra en el torrente sanguíneo.

Los efectos crónicos afectan al corazón, los nervios, los pulmones, el esqueleto y los músculos.

La dosis letal media (DL50) de la margaritatoxina es de 59,9 mg/kg, por lo que las picaduras de Centruroides margaritatus no son peligrosas para los humanos, salvo en caso de reacciones anafilácticas . Provocan dolor, hinchazón local y hormigueo durante 3-4 horas, pero no suele ser necesario ningún tratamiento más allá del alivio sintomático.

Margatoxin leads to the depolarization of human and pig cells in vitro.^[9] By blocking 99% of the KV1.3-channels, margatoxin inhibits the proliferation response of T-cells in mini-swine. Furthermore, it suppresses a B-cell response to allogenicimmunization and inhibits the delayed-type hypersensitivity reaction to tuberculin.^[9] In pigs, the protein's half-life is two hours. When the peptide is continuously infused, it leads to diarrhea and hypersalivation.^[10] However, no major toxic effects are observed in animals. In contrast to when the plasma concentration of margatoxin is higher than 10nM, the transient hyperactivity occurs in pigs. It might be an effect of Kv1.1 and Kv1.2 channels in the brain.

Kv1.3 is already linked with proliferation of lymphocytes, vascular smooth cells, oligodendrocytes and cancer cells. Recent studies have shown that there is therapeutical potential for Kv1.3-blockers such as Margatoxin.

In a minipig treatment a study with margatoxin has been conducted. An eight-day treatment led to a prolonged immune suppression that lasted three to four weeks after termination of dosing. Thymic atrophy (reduced thymus) was observed. Especially the cells in the cortical region had decreased in number^[9]

Neointimal Hyperplasia is the movement and proliferation of smooth muscle cells into the luminal area of a blood vessel. This generates a new inner structure that can block blood flow. This is commonly seen to cause failure of interventional clinical procedures that include placement of stents and bypass grafts.

Due to changes in potassium channel type the vascular smooth muscle cells switch from the contractile to proliferating phenotype. It is suggested that Kv1.3 is important in proliferating vascular smooth muscle cells. Inhibitors of such channels suppress vascular smooth muscle proliferation, stenosis following injury, and neointimal hyperplasia. Studies shows that margatoxin is a high potency inhibitor of vascular cell migration, with an IC50 (half maximal inhibitory concentration) of 85 pM. In this study, a negative effect was also found. There have been vasoconstrictor effects observed in some arteries, but elevated blood pressure has not appeared as a significant concern.^[5]